Released on = July 25, 2007, 8:22 am

Press Release Author = AnaSpec Inc.

Industry = Biotech

Press Release Summary = Today AnaSpec, one of the world's largest providers of
custom and catalog peptides, introduced fourteen (14) new peptides for drug
discovery research.

Press Release Body = July 24, 2007 - San Jose, CA

Today AnaSpec, one of the world's largest providers of custom and catalog peptides,
introduced fourteen (14) new peptides for drug discovery research.

HIV Nef (68-76) - Cat# 61673
This HIV nef peptide 68 to 76 amino acids was identified in HIV-infected
individuals. It is a B7 restricted epitope and a high affinity HLA binder.
Sequence: FPVTPQVPL

Substance P (1-6); amide - Cat# 61690
Substance P (SP) is an important neuropeptide that has been implicated in several
physiological processes. This peptide is 1 to 6 amino acid fragment of SP. This
peptide is one of the products of SP hydrolysis by kidney endopeptidase.
Sequence: RPKPQQ-NH2

Substance P (1-7); amide - Cat# 61691
Substance P (SP) is an important neuropeptide that has been implicated in several
physiological processes. This bioactive N-terminal fragment 1 to 7 amino acid of
substance P is generated by substance P endopeptidase; a predominantly cytosolic
enzyme.
Sequence: RPKPQQF-NH2

Substance P (5-11); amide - Cat# 61692
Substance P (SP) is an important neuropeptide that has been implicated in several
physiological processes. This is fragment 5 to 11 amino acids of substance P.
Sequence: QQFFGLM-NH2

Substance P (8-11) - Cat# 61694
Substance P (SP) is an important neuropeptide that has been implicated in several
physiological processes. This SP fragment 8 to 11 amino acids was used in the
healing of corneal epithelial wounds study. The combination of FGLM-NH2 and IGF-1
promotes corneal epithelial wound healing in diabetic rats; suggesting that this
kind of treatment might prove effective in humans with diabetic keratopathy.
Administration of eyedrops containing both FGLM-NH2 and SSSR is effective for the
treatment of persistent epithelial defects in individuals with neurotrophic
keratopathy.
Sequence: FGLM-NH2

Substance P (9-11) - Cat# 61695
Substance P (SP) is an important neuropeptide that has been implicated in several
physiological processes. This is a SP peptide fragment 9 to 11 amino acid. It is
also a common C-terminal tachykinin motif.
Sequence: GLM-NH2

Influenza Virus A/Aichi/2/68 Haemagglutinin HA1 (195-209); X-31 - Cat# 61696
This is fragment 195 to 209 amino acid from the early Hong Kong influenza virus
A/Aichi/2/68 (X-31). The complete amino acid sequence (328 residues) of
variant-A/Aichi/68 HA`1 was compared to A/Memphis/72 haemagglutinins; and the study
has revealed several differences in structure. The monosaccharide compositions of
the individual carbohydrate units on variant-A/Aichi/68 haemagglutinin differ from
those of the corresponding units in variant-A/Memphis/72 haemagglutinin.
Sequence: YVQASGRVTVSTRRS

Influenza Virus NP (55-69) - Cat# 61698
This is the influenza virus nucleoprotein peptide residues 55 to 69 representing a
T-helper epitope from nucleoprotein.
Sequence: RLIQNSLTIERMVLS

LMP1 (125-133); Latent Membrane Potein (125-133); YLL; minimal epitope - Cat# 61675
This 9 amino acids HLA A2-restricted epitope is the minimal sequence that detects
the Epstein-Barr virus (EBV)-encoded oncogene latent membrane protein (LMP) 1; which
is consistently expressed in multiple EBV-associated malignancies. Analysis of
YLLEMLWRL-specific cytotoxic T lymphocytes (CTLs) revealed that these lymphocytes
are able to lyse EBV-infected B cells expressing different HLA A2 supertype alleles
including A*0201; A*0202; A*0203; A*0204; A*0206; A*6802 and A*6901.
Sequence: YLLEMLWRL

LMP 1 (46-62); Latent Membrane Protein (46-62) - Cat# 61677
This 46 to 62 amino acid peptide from the Epstein-Barr virus (EBV)-encoded oncogene
latent membrane protein (LMP) 1 was derived from the seropositive virus carriers. It
shows CD8+ T-cell-dependent reactivity.
Sequence: DWTGGALLVLYSFALML

LMP1 (51-59); Latent Membrane Protein (51-59); All - Cat# 61680
This peptide is a fragment of the Epstein-Barr virus (EBV)-encoded oncogene latent
membrane protein (LMP) 1; codon 51 to 59. It is a HLA A2-restricted epitope; which
is highly conserved in virus isolates from Caucasian; African; and Southeast Asian
donors.
Sequence: ALLVLYSFA

LL-37; reverse sequence - Cat# 62208
The reverse sequence of LL-37 (see Cat# 61302).
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

Peptide Substrate for Renin 520 Assay kit - Cat# 61872
This FRET peptide is a specific substrate for renin; the aspartyl protease that
cleaves the angiotensinogen to yield angiotensin I that is converted to the
angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in
the control of cardiovascular; renal; and adrenal function that governs body fluid
and electrolyte balance; as well as arterial pressure. Since an overactive
renin-angiotensin system leads to hypertension; renin is an attractive target for
the treatment of this disease. This renin peptide substrate may be used for
screening of renin inhibitors and renin activity. In the FRET peptide the
fluorescence of 5-FAM is quenched by QXLT520. Upon cleavage into two separate
fragments by renin; the fluorescence of 5-FAM is recovered; and can be monitored at
excitation/emission

Web Site = http://www.anaspec.com

Contact Details = 2149 O\'toole Ave.
San Jose, CA 95131
1-408-452-5055
ping@anaspec.com